Peptide
LL37 Research Peptide
A human cathelicidin antimicrobial peptide with immunomodulatory and wound healing properties.
Per pack of 10 vials (5mg×10vials)
Research Use Only. This product is intended strictly for in-vitro laboratory research. It is not a drug or supplement, is not FDA-approved, and is not for human or animal consumption. Not for diagnostic or therapeutic use.
1 box contains 10 vials
Research Purposes Only
This product is intended for laboratory research purposes only. Not for human consumption. By purchasing, you confirm that you are a qualified researcher.
LL37 research information
Research Overview
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans. It is a 37 amino acid peptide released from its precursor hCAP-18 by proteinase 3. Beyond its direct antimicrobial activity against bacteria, viruses, and fungi, LL-37 functions as a signaling molecule that modulates inflammation, wound healing, and immune cell recruitment. It interacts with formyl peptide receptor 2 (FPR2), P2X7 receptor, and EGFR, creating a complex signaling network. Research has focused on its dual role as both an antimicrobial agent and an immunomodulator, particularly in wound healing and barrier defense contexts.
- CAS Number
- 154947-66-7
- Molecular Formula
- C205H340N60O53
- Molar Mass
- 4493.33 g/mol
- Molecular Sequence
- [LL-37, 37 aa]
Research Applications
- Antimicrobial peptide research
- Wound healing studies
- Innate immunity research
- Barrier defense analysis
Available Specifications
| Product Code | Strength | Format | Price |
|---|---|---|---|
| LL5 | 5mg×10vials | 10 vials / pack | $160.00 |
| LL10 | 10mg×10vials | 10 vials / pack | $250.00 |
Quality Control
Certificate of Analysis documentation can be attached here for each batch. Contact support with the product code for current COA availability.
Related Research Guides
In-depth, citation-backed reading on LL37 and adjacent research topics.
Frequently Researched Together
MT-1
From $84.00per pack of 10 vials
MT-2 (Melanotan 2 Acetate)
From $84.00per pack of 10 vials
Gonadorelin Acetate
From $64.00per pack of 10 vials
DSIP
From $40.00per pack of 10 vials