Weight Loss
Pramlintide Research Peptide
Per pack of 10 vials (5mg×10vials)
Research Use Only. This product is intended strictly for in-vitro laboratory research. It is not a drug or supplement, is not FDA-approved, and is not for human or animal consumption. Not for diagnostic or therapeutic use.
1 box contains 10 vials
Research Purposes Only
This product is intended for laboratory research purposes only. Not for human consumption. By purchasing, you confirm that you are a qualified researcher.
Pramlintide research information
Research Overview
Pramlintide is supplied as a lyophilized research compound for qualified laboratory use.
- CAS Number
- 151126-32-8
- Molecular Formula
- C171H267N51O53S2
- Molar Mass
- 3949.43 g/mol
- Molecular Sequence
- KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2
Available Specifications
| Product Code | Strength | Format | Price |
|---|---|---|---|
| PL5 | 5mg×10vials | 10 vials / pack | $240.00 |
| PL10 | 10mg×10vials | 10 vials / pack | $430.00 |
Quality Control
Certificate of Analysis documentation can be attached here for each batch. Contact support with the product code for current COA availability.
Related Research Guides
In-depth, citation-backed reading on Pramlintide and adjacent research topics.
Frequently Researched Together
Semaglutide
From $96.00per pack of 10 vials
Tirzepatide
From $96.00per pack of 10 vials
Tirzepatide (10ml)
From $560.00per pack of 10 vials
Retatrutide
From $140.00per pack of 10 vials