Peptide
VIP Research Peptide
Vasoactive Intestinal Peptide, a neuropeptide with broad immunomodulatory and neuroprotective properties.
Per pack of 10 vials (5mg×10vials)
Research Use Only. This product is intended strictly for in-vitro laboratory research. It is not a drug or supplement, is not FDA-approved, and is not for human or animal consumption. Not for diagnostic or therapeutic use.
1 box contains 10 vials
Research Purposes Only
This product is intended for laboratory research purposes only. Not for human consumption. By purchasing, you confirm that you are a qualified researcher.
VIP research information
Research Overview
VIP (Vasoactive Intestinal Peptide) is a 28 amino acid neuropeptide belonging to the secretin/glucagon superfamily. Originally identified in the intestine, it is now known to be widely distributed throughout the central and peripheral nervous systems. VIP acts through VPAC1 and VPAC2 receptors to produce vasodilation, smooth muscle relaxation, immunomodulation, and neuroprotection. Research has revealed its critical role in circadian rhythm regulation, airway function, and immune homeostasis. Its broad receptor distribution and diverse biological effects make it one of the most versatile neuropeptides in biomedical research.
- CAS Number
- 37221-79-7
- Molecular Formula
- C147H237N43O43S
- Molar Mass
- 3326.79 g/mol
- Molecular Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Research Applications
- Immunomodulation studies
- Circadian rhythm research
- Neuroprotection analysis
- Airway physiology research
Available Specifications
| Product Code | Strength | Format | Price |
|---|---|---|---|
| VP5 | 5mg×10vials | 10 vials / pack | $150.00 |
| VP10 | 10mg×10vials | 10 vials / pack | $210.00 |
Quality Control
Certificate of Analysis documentation can be attached here for each batch. Contact support with the product code for current COA availability.
Related Research Guides
In-depth, citation-backed reading on VIP and adjacent research topics.
Frequently Researched Together
MT-1
From $84.00per pack of 10 vials
MT-2 (Melanotan 2 Acetate)
From $84.00per pack of 10 vials
Gonadorelin Acetate
From $64.00per pack of 10 vials
DSIP
From $40.00per pack of 10 vials