GH Peptides
IGF-1 LR3 Research Peptide
A modified insulin-like growth factor-1 with extended half-life, studied for its potent effects on cell growth and metabolism.
Per pack of 10 vials (0.1mg×10vials)
Research Use Only. This product is intended strictly for in-vitro laboratory research. It is not a drug or supplement, is not FDA-approved, and is not for human or animal consumption. Not for diagnostic or therapeutic use.
1 box contains 10 vials
Research Purposes Only
This product is intended for laboratory research purposes only. Not for human consumption. By purchasing, you confirm that you are a qualified researcher.
IGF-1 LR3 research information
Research Overview
IGF-1 LR3 (Long R3 IGF-1) is a modified form of human IGF-1 with an arginine substitution at position 3 and a 13 amino acid N-terminal extension. These modifications dramatically reduce its binding affinity for IGF binding proteins (IGFBPs), resulting in a much longer half-life and greater bioavailability than native IGF-1. This makes IGF-1 LR3 approximately three times more potent than standard IGF-1 in promoting cell growth and metabolic activity. Researchers use it to study IGF-1 receptor-mediated effects without the complicating factor of IGFBP regulation.
- CAS Number
- 946870-92-4
- Molecular Formula
- C400H625N111O115S9
- Molar Mass
- 9117.62 g/mol
- Molecular Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Research Applications
- IGF-1 receptor studies
- Cell proliferation research
- IGFBP-independent IGF signaling
- Metabolic pathway analysis
Available Specifications
| Product Code | Strength | Format | Price |
|---|---|---|---|
| IG01 | 0.1mg×10vials | 10 vials / pack | $70.00 |
| IG1 | 1mg×10vials | 10 vials / pack | $340.00 |
Quality Control
Certificate of Analysis documentation can be attached here for each batch. Contact support with the product code for current COA availability.
Related Research Guides
In-depth, citation-backed reading on IGF-1 LR3 and adjacent research topics.
Frequently Researched Together
GH 191AA (Somatropin)
From $76.00per pack of 10 vials
GHRP-2 Acetate
From $52.00per pack of 10 vials
GHRP-6 Acetate
From $52.00per pack of 10 vials
CJC-1295 Without DAC
From $150.00per pack of 10 vials