GH Peptides
Sermorelin Acetate Research Peptide
A synthetic analog of GHRH (1 to 29) that stimulates natural growth hormone production and release.
Per pack of 10 vials (2mg×10vials)
Research Use Only. This product is intended strictly for in-vitro laboratory research. It is not a drug or supplement, is not FDA-approved, and is not for human or animal consumption. Not for diagnostic or therapeutic use.
1 box contains 10 vials
Research Purposes Only
This product is intended for laboratory research purposes only. Not for human consumption. By purchasing, you confirm that you are a qualified researcher.
Sermorelin Acetate research information
Research Overview
Sermorelin is the synthetic form of the first 29 amino acids of growth hormone releasing hormone. It acts on the GHRH receptor in the pituitary gland, stimulating the natural production and pulsatile release of growth hormone. Because it works through the body's own regulatory mechanisms, GH release triggered by Sermorelin respects negative feedback loops, making it difficult to produce supraphysiological GH levels. This physiological profile makes Sermorelin valuable in research protocols studying growth hormone deficiency, aging-related GH decline, and the effects of GH optimization within normal ranges.
- CAS Number
- 86168-78-7
- Molecular Formula
- C149H246N44O42S
- Molar Mass
- 3357.93 g/mol
- Molecular Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Research Applications
- GHRH pathway studies
- Physiological GH release research
- Aging-related GH decline
- GH deficiency models
Available Specifications
| Product Code | Strength | Format | Price |
|---|---|---|---|
| SMO2 | 2mg×10vials | 10 vials / pack | $68.00 |
| SMO5 | 5mg×10vials | 10 vials / pack | $140.00 |
| SMO10 | 10mg×10vials | 10 vials / pack | $190.00 |
Quality Control
Certificate of Analysis documentation can be attached here for each batch. Contact support with the product code for current COA availability.
Related Research Guides
In-depth, citation-backed reading on Sermorelin Acetate and adjacent research topics.
Frequently Researched Together
GH 191AA (Somatropin)
From $76.00per pack of 10 vials
GHRP-2 Acetate
From $52.00per pack of 10 vials
GHRP-6 Acetate
From $52.00per pack of 10 vials
CJC-1295 Without DAC
From $150.00per pack of 10 vials